General Information

  • ID:  hor005855
  • Uniprot ID:  Q26181
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGLT
  • Length:  4
  • Propeptide:  AGLTKRSLFDPSCTGVFDRQLLRRLRRVCDDCFNVFREPNVSTECRSNCYNNEVFRQCMEYLLPPHLHEEHRLAVQMVGK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q26181-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005855_AF2.pdbhor005855_ESM.pdb

Physical Information

Mass: 41411 Formula: C15H28N4O6
Absent amino acids: CDEFHIKMNPQRSVWY Common amino acids: AGLT
pI: 6.11 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: 112.5 Boman Index: 510
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 122.5
Instability Index: 750 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8812330
  • Title:  Characterization of hyperglycemic and molt-inhibiting activity from sinus glands of the penaeid shrimp Penaeus vannamei.